Anti UIMC1 pAb (ATL-HPA037503 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA037503-100

Protein Description: ubiquitin interaction motif containing 1
Gene Name: UIMC1
Alternative Gene Name: RAP80
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025878: 84%, ENSRNOG00000016891: 81%
Entrez Gene ID: 51720
Uniprot ID: Q96RL1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PVFENVNVKSFDRCTGHSAEHTQCGKPQESTGRGSAFLKAVQGSGDTSRHCLPTLADAKGLQDTGGTVNYFWGIPFCPDGVDPNQYTKVILCQLE
• Gene Sequence: PVFENVNVKSFDRCTGHSAEHTQCGKPQESTGRGSAFLKAVQGSGDTSRHCLPTLADAKGLQDTGGTVNYFWGIPFCPDGVDPNQYTKVILCQLE
• Gene ID - Mouse: ENSMUSG00000025878
• Gene ID - Rat: ENSRNOG00000016891
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.