Anti UGT3A2 pAb (ATL-HPA059475)

Atlas Antibodies

SKU:
ATL-HPA059475-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
  • Immunofluorescent staining of human cell line SH-SY5Y shows localization to nucleus, cytosol & the Golgi apparatus.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: UDP glycosyltransferase 3 family, polypeptide A2
Gene Name: UGT3A2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049152: 73%, ENSRNOG00000059568: 63%
Entrez Gene ID: 167127
Uniprot ID: Q3SY77
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IPLFGDQPENMVRVEAKKFGVSIQLKKLKAETLALKMKQIM
Gene Sequence IPLFGDQPENMVRVEAKKFGVSIQLKKLKAETLALKMKQIM
Gene ID - Mouse ENSMUSG00000049152
Gene ID - Rat ENSRNOG00000059568
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti UGT3A2 pAb (ATL-HPA059475)
Datasheet Anti UGT3A2 pAb (ATL-HPA059475) Datasheet (External Link)
Vendor Page Anti UGT3A2 pAb (ATL-HPA059475) at Atlas Antibodies

Documents & Links for Anti UGT3A2 pAb (ATL-HPA059475)
Datasheet Anti UGT3A2 pAb (ATL-HPA059475) Datasheet (External Link)
Vendor Page Anti UGT3A2 pAb (ATL-HPA059475)