Anti UGT3A1 pAb (ATL-HPA047697)

Atlas Antibodies

SKU: ATL-HPA047697-25

• 

Protein Description: UDP glycosyltransferase 3 family, polypeptide A1
Gene Name: UGT3A1
Alternative Gene Name: FLJ34658
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049152: 45%, ENSRNOG00000046594: 27%
Entrez Gene ID: 133688
Uniprot ID: Q6NUS8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KSYQVIRWFSPEDHQKRIKKHFDSYIETALDGRKESEALVKLMEIFGTQCSYLLSRKDIM
• Gene Sequence: KSYQVIRWFSPEDHQKRIKKHFDSYIETALDGRKESEALVKLMEIFGTQCSYLLSRKDIM
• Gene ID - Mouse: ENSMUSG00000049152
• Gene ID - Rat: ENSRNOG00000046594
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.