Anti UGT3A1 pAb (ATL-HPA047697)
Atlas Antibodies
- Catalog No.:
- ATL-HPA047697-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: UGT3A1
Alternative Gene Name: FLJ34658
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049152: 45%, ENSRNOG00000046594: 27%
Entrez Gene ID: 133688
Uniprot ID: Q6NUS8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KSYQVIRWFSPEDHQKRIKKHFDSYIETALDGRKESEALVKLMEIFGTQCSYLLSRKDIM |
| Gene Sequence | KSYQVIRWFSPEDHQKRIKKHFDSYIETALDGRKESEALVKLMEIFGTQCSYLLSRKDIM |
| Gene ID - Mouse | ENSMUSG00000049152 |
| Gene ID - Rat | ENSRNOG00000046594 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti UGT3A1 pAb (ATL-HPA047697) | |
| Datasheet | Anti UGT3A1 pAb (ATL-HPA047697) Datasheet (External Link) |
| Vendor Page | Anti UGT3A1 pAb (ATL-HPA047697) at Atlas Antibodies |
| Documents & Links for Anti UGT3A1 pAb (ATL-HPA047697) | |
| Datasheet | Anti UGT3A1 pAb (ATL-HPA047697) Datasheet (External Link) |
| Vendor Page | Anti UGT3A1 pAb (ATL-HPA047697) |