Anti UGT1A6 pAb (ATL-HPA054065 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA054065-25

Protein Description: UDP glucuronosyltransferase 1 family, polypeptide A6
Gene Name: UGT1A6
Alternative Gene Name: GNT1, HLUGP, UGT1F
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090124: 63%, ENSRNOG00000018740: 73%
Entrez Gene ID: 54578
Uniprot ID: P19224
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WLSMKDIVEVLSDRGHEIVVVVPEVNLLLKESKYYTRKIYPVPYDQEELKNRYQSFGNNHFAERSFLTAPQTEYRNNMIVIGLY
• Gene Sequence: WLSMKDIVEVLSDRGHEIVVVVPEVNLLLKESKYYTRKIYPVPYDQEELKNRYQSFGNNHFAERSFLTAPQTEYRNNMIVIGLY
• Gene ID - Mouse: ENSMUSG00000090124
• Gene ID - Rat: ENSRNOG00000018740
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.