Anti UFL1 pAb (ATL-HPA030558)

Atlas Antibodies

Catalog No.: ATL-HPA030558-25

Protein Description: UFM1-specific ligase 1
Gene Name: UFL1
Alternative Gene Name: KIAA0776, Maxer, NLBP, RCAD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040359: 93%, ENSRNOG00000007831: 96%
Entrez Gene ID: 23376
Uniprot ID: O94874
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GLFSAITRPTAVNSLISKYGFQEQLLYSVLEELVNSGRLRGTVVGGRQDKAVFVPDIYSRTQSTWVDSFFRQNGYLEFDALSRLGIPDAVS
• Gene Sequence: GLFSAITRPTAVNSLISKYGFQEQLLYSVLEELVNSGRLRGTVVGGRQDKAVFVPDIYSRTQSTWVDSFFRQNGYLEFDALSRLGIPDAVS
• Gene ID - Mouse: ENSMUSG00000040359
• Gene ID - Rat: ENSRNOG00000007831
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti UFL1 pAb (ATL-HPA030558) – 2 Found

Qin, Bo; Yu, Jia; Nowsheen, Somaira; Wang, Minghui; Tu, Xinyi; Liu, Tongzheng; Li, Honglin; Wang, Liewei; Lou, Zhenkun. UFL1 promotes histone H4 ufmylation and ATM activation. Nature Communications. 2019;10(1):1242. 

Qin, Bo; Yu, Jia; Nowsheen, Somaira; Zhao, Fei; Wang, Liewei; Lou, Zhenkun. STK38 promotes ATM activation by acting as a reader of histone H4 ufmylation. Science Advances. 2020;6(23):eaax8214.