Anti UFD1 pAb (ATL-HPA030286)
Atlas Antibodies
- Catalog No.:
- ATL-HPA030286-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: UFD1
Alternative Gene Name: UFD1L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005262: 100%, ENSRNOG00000047394: 100%
Entrez Gene ID: 7353
Uniprot ID: Q92890
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MFSFNMFDHPIPRVFQNRFSTQYRCFSVSMLAGPNDRSDVEKGGKIIMPPSALDQLSR |
| Gene Sequence | MFSFNMFDHPIPRVFQNRFSTQYRCFSVSMLAGPNDRSDVEKGGKIIMPPSALDQLSR |
| Gene ID - Mouse | ENSMUSG00000005262 |
| Gene ID - Rat | ENSRNOG00000047394 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti UFD1 pAb (ATL-HPA030286) | |
| Datasheet | Anti UFD1 pAb (ATL-HPA030286) Datasheet (External Link) |
| Vendor Page | Anti UFD1 pAb (ATL-HPA030286) at Atlas Antibodies |
| Documents & Links for Anti UFD1 pAb (ATL-HPA030286) | |
| Datasheet | Anti UFD1 pAb (ATL-HPA030286) Datasheet (External Link) |
| Vendor Page | Anti UFD1 pAb (ATL-HPA030286) |