Anti UFD1 pAb (ATL-HPA030286)

Atlas Antibodies

Catalog No.: ATL-HPA030286-25

Protein Description: ubiquitin recognition factor in ER associated degradation 1
Gene Name: UFD1
Alternative Gene Name: UFD1L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005262: 100%, ENSRNOG00000047394: 100%
Entrez Gene ID: 7353
Uniprot ID: Q92890
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MFSFNMFDHPIPRVFQNRFSTQYRCFSVSMLAGPNDRSDVEKGGKIIMPPSALDQLSR
• Gene Sequence: MFSFNMFDHPIPRVFQNRFSTQYRCFSVSMLAGPNDRSDVEKGGKIIMPPSALDQLSR
• Gene ID - Mouse: ENSMUSG00000005262
• Gene ID - Rat: ENSRNOG00000047394
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.