Anti UCMA pAb (ATL-HPA046718)

Atlas Antibodies

Catalog No.:
ATL-HPA046718-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: upper zone of growth plate and cartilage matrix associated
Gene Name: UCMA
Alternative Gene Name: C10orf49
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026668: 88%, ENSRNOG00000017987: 88%
Entrez Gene ID: 221044
Uniprot ID: Q8WVF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YYEEQRNEFENFVEEQNDEQEERSREAVEQWRQWHYDGLHPSYLYNRHHT
Gene Sequence YYEEQRNEFENFVEEQNDEQEERSREAVEQWRQWHYDGLHPSYLYNRHHT
Gene ID - Mouse ENSMUSG00000026668
Gene ID - Rat ENSRNOG00000017987
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UCMA pAb (ATL-HPA046718)
Datasheet Anti UCMA pAb (ATL-HPA046718) Datasheet (External Link)
Vendor Page Anti UCMA pAb (ATL-HPA046718) at Atlas Antibodies

Documents & Links for Anti UCMA pAb (ATL-HPA046718)
Datasheet Anti UCMA pAb (ATL-HPA046718) Datasheet (External Link)
Vendor Page Anti UCMA pAb (ATL-HPA046718)