Anti UCMA pAb (ATL-HPA046718)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046718-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: UCMA
Alternative Gene Name: C10orf49
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026668: 88%, ENSRNOG00000017987: 88%
Entrez Gene ID: 221044
Uniprot ID: Q8WVF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YYEEQRNEFENFVEEQNDEQEERSREAVEQWRQWHYDGLHPSYLYNRHHT |
| Gene Sequence | YYEEQRNEFENFVEEQNDEQEERSREAVEQWRQWHYDGLHPSYLYNRHHT |
| Gene ID - Mouse | ENSMUSG00000026668 |
| Gene ID - Rat | ENSRNOG00000017987 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti UCMA pAb (ATL-HPA046718) | |
| Datasheet | Anti UCMA pAb (ATL-HPA046718) Datasheet (External Link) |
| Vendor Page | Anti UCMA pAb (ATL-HPA046718) at Atlas Antibodies |
| Documents & Links for Anti UCMA pAb (ATL-HPA046718) | |
| Datasheet | Anti UCMA pAb (ATL-HPA046718) Datasheet (External Link) |
| Vendor Page | Anti UCMA pAb (ATL-HPA046718) |