Anti UCK1 pAb (ATL-HPA050969)

Atlas Antibodies

Catalog No.:
ATL-HPA050969-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: uridine-cytidine kinase 1
Gene Name: UCK1
Alternative Gene Name: FLJ12255, URK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002550: 82%, ENSRNOG00000011467: 84%
Entrez Gene ID: 83549
Uniprot ID: Q9HA47
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IQDILNGDICKWHRGGSNGRSYKRTFSEPGDHPGMLTSGKRSHLESSSRP
Gene Sequence IQDILNGDICKWHRGGSNGRSYKRTFSEPGDHPGMLTSGKRSHLESSSRP
Gene ID - Mouse ENSMUSG00000002550
Gene ID - Rat ENSRNOG00000011467
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UCK1 pAb (ATL-HPA050969)
Datasheet Anti UCK1 pAb (ATL-HPA050969) Datasheet (External Link)
Vendor Page Anti UCK1 pAb (ATL-HPA050969) at Atlas Antibodies

Documents & Links for Anti UCK1 pAb (ATL-HPA050969)
Datasheet Anti UCK1 pAb (ATL-HPA050969) Datasheet (External Link)
Vendor Page Anti UCK1 pAb (ATL-HPA050969)