Anti UBXN2B pAb (ATL-HPA045278)

Atlas Antibodies

Catalog No.:
ATL-HPA045278-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: UBX domain protein 2B
Gene Name: UBXN2B
Alternative Gene Name: p37
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028243: 69%, ENSRNOG00000009137: 75%
Entrez Gene ID: 137886
Uniprot ID: Q14CS0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GEQERRSSGPRPPSARDLQLALAELYEDEVKCKSSKSNRPKATVFKSPRTPPQRFYSSEHEYSGLNIVRPS
Gene Sequence GEQERRSSGPRPPSARDLQLALAELYEDEVKCKSSKSNRPKATVFKSPRTPPQRFYSSEHEYSGLNIVRPS
Gene ID - Mouse ENSMUSG00000028243
Gene ID - Rat ENSRNOG00000009137
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UBXN2B pAb (ATL-HPA045278)
Datasheet Anti UBXN2B pAb (ATL-HPA045278) Datasheet (External Link)
Vendor Page Anti UBXN2B pAb (ATL-HPA045278) at Atlas Antibodies

Documents & Links for Anti UBXN2B pAb (ATL-HPA045278)
Datasheet Anti UBXN2B pAb (ATL-HPA045278) Datasheet (External Link)
Vendor Page Anti UBXN2B pAb (ATL-HPA045278)