Anti UBXN10 pAb (ATL-HPA028564)

Atlas Antibodies

Catalog No.: ATL-HPA028564-25

Protein Description: UBX domain protein 10
Gene Name: UBXN10
Alternative Gene Name: FLJ25429, UBXD3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043621: 81%, ENSRNOG00000027731: 80%
Entrez Gene ID: 127733
Uniprot ID: Q96LJ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RFVRHFRPTDDLQTIVAVAEQKNKTSYRHCSIETMEVPRRRFSDLTKSLQECRIPHKSVLGISLEDGEGW
• Gene Sequence: RFVRHFRPTDDLQTIVAVAEQKNKTSYRHCSIETMEVPRRRFSDLTKSLQECRIPHKSVLGISLEDGEGW
• Gene ID - Mouse: ENSMUSG00000043621
• Gene ID - Rat: ENSRNOG00000027731
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti UBXN10 pAb (ATL-HPA028564) – 1 Found

Raman, Malavika; Sergeev, Mikhail; Garnaas, Maija; Lydeard, John R; Huttlin, Edward L; Goessling, Wolfram; Shah, Jagesh V; Harper, J Wade. Systematic proteomics of the VCP-UBXD adaptor network identifies a role for UBXN10 in regulating ciliogenesis. Nature Cell Biology. 2015;17(10):1356-69.