Anti UBR2 pAb (ATL-HPA027869)

Atlas Antibodies

Catalog No.: ATL-HPA027869-25

Protein Description: ubiquitin protein ligase E3 component n-recognin 2
Gene Name: UBR2
Alternative Gene Name: bA49A4.1, C6orf133, dJ392M17.3, KIAA0349
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023977: 59%, ENSRNOG00000015813: 65%
Entrez Gene ID: 23304
Uniprot ID: Q8IWV8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QPNLTQWIRTISQQIKALQFLRKEESTPNNASTKNSENVDELQLPEGFRPDFRPKIPYSESIKEMLTTFGTATYKVGLKVHPN
• Gene Sequence: QPNLTQWIRTISQQIKALQFLRKEESTPNNASTKNSENVDELQLPEGFRPDFRPKIPYSESIKEMLTTFGTATYKVGLKVHPN
• Gene ID - Mouse: ENSMUSG00000023977
• Gene ID - Rat: ENSRNOG00000015813
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.