Anti UBL7 pAb (ATL-HPA041897)

Atlas Antibodies

Catalog No.:
ATL-HPA041897-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ubiquitin-like 7
Gene Name: UBL7
Alternative Gene Name: BMSC-UbP, MGC14421
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055720: 99%, ENSRNOG00000007442: 99%
Entrez Gene ID: 84993
Uniprot ID: Q96S82
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLGYSGAAGPRPITQSELATALALASTPESSSHTPTPGTQGHSSGTSPMSSGVQSGTPITNDLFSQALQHALQASGQPSLQSQWQPQLQQLRDMGIQDDELS
Gene Sequence SLGYSGAAGPRPITQSELATALALASTPESSSHTPTPGTQGHSSGTSPMSSGVQSGTPITNDLFSQALQHALQASGQPSLQSQWQPQLQQLRDMGIQDDELS
Gene ID - Mouse ENSMUSG00000055720
Gene ID - Rat ENSRNOG00000007442
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UBL7 pAb (ATL-HPA041897)
Datasheet Anti UBL7 pAb (ATL-HPA041897) Datasheet (External Link)
Vendor Page Anti UBL7 pAb (ATL-HPA041897) at Atlas Antibodies

Documents & Links for Anti UBL7 pAb (ATL-HPA041897)
Datasheet Anti UBL7 pAb (ATL-HPA041897) Datasheet (External Link)
Vendor Page Anti UBL7 pAb (ATL-HPA041897)