Anti UBL7 pAb (ATL-HPA040423)
Atlas Antibodies
- Catalog No.:
- ATL-HPA040423-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: UBL7
Alternative Gene Name: BMSC-UbP, MGC14421
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055720: 94%, ENSRNOG00000007442: 94%
Entrez Gene ID: 84993
Uniprot ID: Q96S82
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IALGVLQDKDLFSVFADPNMLDTLVPAHPALVNAIVLVLHSVAGSAPMPGTDSSSRSMPSSSYRDMPGGFLFEGLSDDEDDFHPNTRST |
| Gene Sequence | IALGVLQDKDLFSVFADPNMLDTLVPAHPALVNAIVLVLHSVAGSAPMPGTDSSSRSMPSSSYRDMPGGFLFEGLSDDEDDFHPNTRST |
| Gene ID - Mouse | ENSMUSG00000055720 |
| Gene ID - Rat | ENSRNOG00000007442 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti UBL7 pAb (ATL-HPA040423) | |
| Datasheet | Anti UBL7 pAb (ATL-HPA040423) Datasheet (External Link) |
| Vendor Page | Anti UBL7 pAb (ATL-HPA040423) at Atlas Antibodies |
| Documents & Links for Anti UBL7 pAb (ATL-HPA040423) | |
| Datasheet | Anti UBL7 pAb (ATL-HPA040423) Datasheet (External Link) |
| Vendor Page | Anti UBL7 pAb (ATL-HPA040423) |