Anti UBL4A pAb (ATL-HPA003617)

Atlas Antibodies

Catalog No.: ATL-HPA003617-25

Protein Description: ubiquitin-like 4A
Gene Name: UBL4A
Alternative Gene Name: DXS254E, GDX, GET5, MDY2, TMA24, UBL4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015290: 89%, ENSRNOG00000053061: 88%
Entrez Gene ID: 8266
Uniprot ID: P11441
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDYSIGPNSKLNLVVKPLEKVLLEEGEAQRLADSPPPQVWQLISKVLARHFSAADASRVLEQLQRDYERSLSRLTLDDIERLASRFLHPEVTETMEKG
• Gene Sequence: VSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDYSIGPNSKLNLVVKPLEKVLLEEGEAQRLADSPPPQVWQLISKVLARHFSAADASRVLEQLQRDYERSLSRLTLDDIERLASRFLHPEVTETMEKG
• Gene ID - Mouse: ENSMUSG00000015290
• Gene ID - Rat: ENSRNOG00000053061
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.