Anti UBIAD1 pAb (ATL-HPA044862)

Atlas Antibodies

Catalog No.:
ATL-HPA044862-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: UbiA prenyltransferase domain containing 1
Gene Name: UBIAD1
Alternative Gene Name: SCCD, TERE1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047719: 82%, ENSRNOG00000009575: 80%
Entrez Gene ID: 29914
Uniprot ID: Q9Y5Z9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAASQVLGEKINILSGETVKAGDRDPLGNDCPEQDRLPQRSWRQKCASYVLALRPWSFSASLTPVALGSALAYRSHGVLDPR
Gene Sequence MAASQVLGEKINILSGETVKAGDRDPLGNDCPEQDRLPQRSWRQKCASYVLALRPWSFSASLTPVALGSALAYRSHGVLDPR
Gene ID - Mouse ENSMUSG00000047719
Gene ID - Rat ENSRNOG00000009575
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UBIAD1 pAb (ATL-HPA044862)
Datasheet Anti UBIAD1 pAb (ATL-HPA044862) Datasheet (External Link)
Vendor Page Anti UBIAD1 pAb (ATL-HPA044862) at Atlas Antibodies

Documents & Links for Anti UBIAD1 pAb (ATL-HPA044862)
Datasheet Anti UBIAD1 pAb (ATL-HPA044862) Datasheet (External Link)
Vendor Page Anti UBIAD1 pAb (ATL-HPA044862)