Anti UBIAD1 pAb (ATL-HPA044862)

Atlas Antibodies

Catalog No.: ATL-HPA044862-25

Protein Description: UbiA prenyltransferase domain containing 1
Gene Name: UBIAD1
Alternative Gene Name: SCCD, TERE1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047719: 82%, ENSRNOG00000009575: 80%
Entrez Gene ID: 29914
Uniprot ID: Q9Y5Z9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAASQVLGEKINILSGETVKAGDRDPLGNDCPEQDRLPQRSWRQKCASYVLALRPWSFSASLTPVALGSALAYRSHGVLDPR
• Gene Sequence: MAASQVLGEKINILSGETVKAGDRDPLGNDCPEQDRLPQRSWRQKCASYVLALRPWSFSASLTPVALGSALAYRSHGVLDPR
• Gene ID - Mouse: ENSMUSG00000047719
• Gene ID - Rat: ENSRNOG00000009575
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.