Anti UBFD1 pAb (ATL-HPA051746)

Atlas Antibodies

Catalog No.:
ATL-HPA051746-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ubiquitin family domain containing 1
Gene Name: UBFD1
Alternative Gene Name: FLJ38870, FLJ42145, UBPH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030870: 100%, ENSRNOG00000018243: 99%
Entrez Gene ID: 56061
Uniprot ID: O14562
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NKKEPLCRQKQHRKVLDKGKPEDVMPSVKGAQERLPTVPLSGMYNKSGGKVRLTFKLEQDQLWIGTKERTEKLPMGSIKNVVSEPIEGHEDYHMMAFQLGPTEASYYWVYWVPTQ
Gene Sequence NKKEPLCRQKQHRKVLDKGKPEDVMPSVKGAQERLPTVPLSGMYNKSGGKVRLTFKLEQDQLWIGTKERTEKLPMGSIKNVVSEPIEGHEDYHMMAFQLGPTEASYYWVYWVPTQ
Gene ID - Mouse ENSMUSG00000030870
Gene ID - Rat ENSRNOG00000018243
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UBFD1 pAb (ATL-HPA051746)
Datasheet Anti UBFD1 pAb (ATL-HPA051746) Datasheet (External Link)
Vendor Page Anti UBFD1 pAb (ATL-HPA051746) at Atlas Antibodies

Documents & Links for Anti UBFD1 pAb (ATL-HPA051746)
Datasheet Anti UBFD1 pAb (ATL-HPA051746) Datasheet (External Link)
Vendor Page Anti UBFD1 pAb (ATL-HPA051746)