Anti UBE2W pAb (ATL-HPA045161)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045161-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: UBE2W
Alternative Gene Name: FLJ11011
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025939: 99%, ENSRNOG00000050465: 100%
Entrez Gene ID: 55284
Uniprot ID: Q96B02
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQVMFTGENIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLSSCKEKRRPPDNSFYVRTCNKNPKKTKWWY |
| Gene Sequence | DPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQVMFTGENIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLSSCKEKRRPPDNSFYVRTCNKNPKKTKWWY |
| Gene ID - Mouse | ENSMUSG00000025939 |
| Gene ID - Rat | ENSRNOG00000050465 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti UBE2W pAb (ATL-HPA045161) | |
| Datasheet | Anti UBE2W pAb (ATL-HPA045161) Datasheet (External Link) |
| Vendor Page | Anti UBE2W pAb (ATL-HPA045161) at Atlas Antibodies |
| Documents & Links for Anti UBE2W pAb (ATL-HPA045161) | |
| Datasheet | Anti UBE2W pAb (ATL-HPA045161) Datasheet (External Link) |
| Vendor Page | Anti UBE2W pAb (ATL-HPA045161) |
| Citations for Anti UBE2W pAb (ATL-HPA045161) – 1 Found |
| Liyasova, Mariya S; Ma, Ke; Voeller, Donna; Ryan, Philip E; Chen, Jinqiu; Klevit, Rachel E; Lipkowitz, Stanley. Cbl interacts with multiple E2s in vitro and in cells. Plos One. 14(5):e0216967. PubMed |