Anti UBE2W pAb (ATL-HPA045161)

Atlas Antibodies

Catalog No.:
ATL-HPA045161-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: ubiquitin-conjugating enzyme E2W (putative)
Gene Name: UBE2W
Alternative Gene Name: FLJ11011
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025939: 99%, ENSRNOG00000050465: 100%
Entrez Gene ID: 55284
Uniprot ID: Q96B02
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQVMFTGENIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLSSCKEKRRPPDNSFYVRTCNKNPKKTKWWY
Gene Sequence DPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQVMFTGENIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLSSCKEKRRPPDNSFYVRTCNKNPKKTKWWY
Gene ID - Mouse ENSMUSG00000025939
Gene ID - Rat ENSRNOG00000050465
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UBE2W pAb (ATL-HPA045161)
Datasheet Anti UBE2W pAb (ATL-HPA045161) Datasheet (External Link)
Vendor Page Anti UBE2W pAb (ATL-HPA045161) at Atlas Antibodies

Documents & Links for Anti UBE2W pAb (ATL-HPA045161)
Datasheet Anti UBE2W pAb (ATL-HPA045161) Datasheet (External Link)
Vendor Page Anti UBE2W pAb (ATL-HPA045161)
Citations for Anti UBE2W pAb (ATL-HPA045161) – 1 Found
Liyasova, Mariya S; Ma, Ke; Voeller, Donna; Ryan, Philip E; Chen, Jinqiu; Klevit, Rachel E; Lipkowitz, Stanley. Cbl interacts with multiple E2s in vitro and in cells. Plos One. 14(5):e0216967.  PubMed