Anti UBE2N pAb (ATL-HPA044976 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA044976-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: ubiquitin-conjugating enzyme E2N
Gene Name: UBE2N
Alternative Gene Name: MGC8489, UBC13, UbcH-ben
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074781: 100%, ENSRNOG00000058053: 100%
Entrez Gene ID: 7334
Uniprot ID: P61088
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IIKETQRLLAEPVPGIKAEPDESNARYFHVVIA
Gene Sequence IIKETQRLLAEPVPGIKAEPDESNARYFHVVIA
Gene ID - Mouse ENSMUSG00000074781
Gene ID - Rat ENSRNOG00000058053
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UBE2N pAb (ATL-HPA044976 w/enhanced validation)
Datasheet Anti UBE2N pAb (ATL-HPA044976 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti UBE2N pAb (ATL-HPA044976 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti UBE2N pAb (ATL-HPA044976 w/enhanced validation)
Datasheet Anti UBE2N pAb (ATL-HPA044976 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti UBE2N pAb (ATL-HPA044976 w/enhanced validation)