Anti UBE2L3 pAb (ATL-HPA045609)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045609-100
- Shipping:
- Calculated at Checkout
$554.00
Gene Name: UBE2L3
Alternative Gene Name: UBCH7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038965: 100%, ENSRNOG00000030467: 44%
Entrez Gene ID: 7332
Uniprot ID: P68036
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MAASRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFK |
Gene Sequence | MAASRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFK |
Gene ID - Mouse | ENSMUSG00000038965 |
Gene ID - Rat | ENSRNOG00000030467 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti UBE2L3 pAb (ATL-HPA045609) | |
Datasheet | Anti UBE2L3 pAb (ATL-HPA045609) Datasheet (External Link) |
Vendor Page | Anti UBE2L3 pAb (ATL-HPA045609) at Atlas Antibodies |
Documents & Links for Anti UBE2L3 pAb (ATL-HPA045609) | |
Datasheet | Anti UBE2L3 pAb (ATL-HPA045609) Datasheet (External Link) |
Vendor Page | Anti UBE2L3 pAb (ATL-HPA045609) |