Anti UBE2C pAb (ATL-HPA034569)

Atlas Antibodies

Catalog No.:
ATL-HPA034569-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: ubiquitin-conjugating enzyme E2C
Gene Name: UBE2C
Alternative Gene Name: UBCH10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001403: 98%, ENSRNOG00000015131: 100%
Entrez Gene ID: 11065
Uniprot ID: O00762
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVD
Gene Sequence GPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVD
Gene ID - Mouse ENSMUSG00000001403
Gene ID - Rat ENSRNOG00000015131
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UBE2C pAb (ATL-HPA034569)
Datasheet Anti UBE2C pAb (ATL-HPA034569) Datasheet (External Link)
Vendor Page Anti UBE2C pAb (ATL-HPA034569) at Atlas Antibodies

Documents & Links for Anti UBE2C pAb (ATL-HPA034569)
Datasheet Anti UBE2C pAb (ATL-HPA034569) Datasheet (External Link)
Vendor Page Anti UBE2C pAb (ATL-HPA034569)