Anti UBD pAb (ATL-HPA043710)

Atlas Antibodies

Catalog No.:
ATL-HPA043710-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: ubiquitin D
Gene Name: UBD
Alternative Gene Name: FAT10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035186: 70%, ENSRNOG00000000768: 75%
Entrez Gene ID: 10537
Uniprot ID: O15205
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NASCLCVHVRSEEWDLMTFDANPYDSVKKIKEHVRSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDKEKTIHLTLKVVKP
Gene Sequence NASCLCVHVRSEEWDLMTFDANPYDSVKKIKEHVRSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDKEKTIHLTLKVVKP
Gene ID - Mouse ENSMUSG00000035186
Gene ID - Rat ENSRNOG00000000768
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UBD pAb (ATL-HPA043710)
Datasheet Anti UBD pAb (ATL-HPA043710) Datasheet (External Link)
Vendor Page Anti UBD pAb (ATL-HPA043710) at Atlas Antibodies

Documents & Links for Anti UBD pAb (ATL-HPA043710)
Datasheet Anti UBD pAb (ATL-HPA043710) Datasheet (External Link)
Vendor Page Anti UBD pAb (ATL-HPA043710)