Anti UBD pAb (ATL-HPA043710)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043710-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: UBD
Alternative Gene Name: FAT10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035186: 70%, ENSRNOG00000000768: 75%
Entrez Gene ID: 10537
Uniprot ID: O15205
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NASCLCVHVRSEEWDLMTFDANPYDSVKKIKEHVRSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDKEKTIHLTLKVVKP |
| Gene Sequence | NASCLCVHVRSEEWDLMTFDANPYDSVKKIKEHVRSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDKEKTIHLTLKVVKP |
| Gene ID - Mouse | ENSMUSG00000035186 |
| Gene ID - Rat | ENSRNOG00000000768 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti UBD pAb (ATL-HPA043710) | |
| Datasheet | Anti UBD pAb (ATL-HPA043710) Datasheet (External Link) |
| Vendor Page | Anti UBD pAb (ATL-HPA043710) at Atlas Antibodies |
| Documents & Links for Anti UBD pAb (ATL-HPA043710) | |
| Datasheet | Anti UBD pAb (ATL-HPA043710) Datasheet (External Link) |
| Vendor Page | Anti UBD pAb (ATL-HPA043710) |