Anti UBAP2L pAb (ATL-HPA035068)

Atlas Antibodies

Catalog No.: ATL-HPA035068-25

Protein Description: ubiquitin associated protein 2-like
Gene Name: UBAP2L
Alternative Gene Name: KIAA0144, NICE-4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042520: 100%, ENSRNOG00000017990: 79%
Entrez Gene ID: 9898
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PINPATAAAYPPAPFMHILTPHQQPHSQILHHHLQQDGQLPYLQMILCCQRQQEEQTGSGQRSQTSSIPQK
• Gene Sequence: PINPATAAAYPPAPFMHILTPHQQPHSQILHHHLQQDGQLPYLQMILCCQRQQEEQTGSGQRSQTSSIPQK
• Gene ID - Mouse: ENSMUSG00000042520
• Gene ID - Rat: ENSRNOG00000017990
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti UBAP2L pAb (ATL-HPA035068) – 1 Found

Yoshida, Kosuke; Kajiyama, Hiroaki; Inami, Eri; Tamauchi, Satoshi; Ikeda, Yoshiki; Yoshikawa, Nobuhisa; Nishino, Kimihiro; Utsumi, Fumi; Niimi, Kaoru; Suzuki, Shiro; Shibata, Kiyosumi; Nawa, Akihiro; Kikkawa, Fumitaka. Clinical Significance of Ubiquitin-associated Protein 2-like in Patients With Uterine Cervical Cancer. In Vivo (Athens, Greece). 2020;34(1):109-116.