Anti UBAP2L pAb (ATL-HPA035068)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035068-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: UBAP2L
Alternative Gene Name: KIAA0144, NICE-4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042520: 100%, ENSRNOG00000017990: 79%
Entrez Gene ID: 9898
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PINPATAAAYPPAPFMHILTPHQQPHSQILHHHLQQDGQLPYLQMILCCQRQQEEQTGSGQRSQTSSIPQK |
| Gene Sequence | PINPATAAAYPPAPFMHILTPHQQPHSQILHHHLQQDGQLPYLQMILCCQRQQEEQTGSGQRSQTSSIPQK |
| Gene ID - Mouse | ENSMUSG00000042520 |
| Gene ID - Rat | ENSRNOG00000017990 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti UBAP2L pAb (ATL-HPA035068) | |
| Datasheet | Anti UBAP2L pAb (ATL-HPA035068) Datasheet (External Link) |
| Vendor Page | Anti UBAP2L pAb (ATL-HPA035068) at Atlas Antibodies |
| Documents & Links for Anti UBAP2L pAb (ATL-HPA035068) | |
| Datasheet | Anti UBAP2L pAb (ATL-HPA035068) Datasheet (External Link) |
| Vendor Page | Anti UBAP2L pAb (ATL-HPA035068) |
| Citations for Anti UBAP2L pAb (ATL-HPA035068) – 1 Found |
| Yoshida, Kosuke; Kajiyama, Hiroaki; Inami, Eri; Tamauchi, Satoshi; Ikeda, Yoshiki; Yoshikawa, Nobuhisa; Nishino, Kimihiro; Utsumi, Fumi; Niimi, Kaoru; Suzuki, Shiro; Shibata, Kiyosumi; Nawa, Akihiro; Kikkawa, Fumitaka. Clinical Significance of Ubiquitin-associated Protein 2-like in Patients With Uterine Cervical Cancer. In Vivo (Athens, Greece). 2020;34(1):109-116. PubMed |