Anti U2SURP pAb (ATL-HPA037545)
Atlas Antibodies
- Catalog No.:
- ATL-HPA037545-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: U2SURP
Alternative Gene Name: fSAPa, SR140
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032407: 100%, ENSRNOG00000008607: 99%
Entrez Gene ID: 23350
Uniprot ID: O15042
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EEELDGAPLEDVDGIPIDATPIDDLDGVPIKSLDDDLDGVPLDATEDSKKNEPIFKVAPSKWEAVDESELEAQAVTTSKWEL |
| Gene Sequence | EEELDGAPLEDVDGIPIDATPIDDLDGVPIKSLDDDLDGVPLDATEDSKKNEPIFKVAPSKWEAVDESELEAQAVTTSKWEL |
| Gene ID - Mouse | ENSMUSG00000032407 |
| Gene ID - Rat | ENSRNOG00000008607 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti U2SURP pAb (ATL-HPA037545) | |
| Datasheet | Anti U2SURP pAb (ATL-HPA037545) Datasheet (External Link) |
| Vendor Page | Anti U2SURP pAb (ATL-HPA037545) at Atlas Antibodies |
| Documents & Links for Anti U2SURP pAb (ATL-HPA037545) | |
| Datasheet | Anti U2SURP pAb (ATL-HPA037545) Datasheet (External Link) |
| Vendor Page | Anti U2SURP pAb (ATL-HPA037545) |