Anti TYW1B pAb (ATL-HPA047052)

Atlas Antibodies

Catalog No.: ATL-HPA047052-25

Protein Description: tRNA-yW synthesizing protein 1 homolog B (S. cerevisiae)
Gene Name: TYW1B
Alternative Gene Name: LINC00069, MGC87315, NCRNA00069, RSAFD2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056310: 67%, ENSRNOG00000024352: 67%
Entrez Gene ID: 441250
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RVMSRGEGDCDVVKSKHGSIEANFRAWKTKFISQLQALQKGERKKSCGGHCKKGKCESHQHGSEEREEGSQEQDELHHR
• Gene Sequence: RVMSRGEGDCDVVKSKHGSIEANFRAWKTKFISQLQALQKGERKKSCGGHCKKGKCESHQHGSEEREEGSQEQDELHHR
• Gene ID - Mouse: ENSMUSG00000056310
• Gene ID - Rat: ENSRNOG00000024352
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.