Anti TYW1B pAb (ATL-HPA047052)

Atlas Antibodies

Catalog No.:
ATL-HPA047052-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: tRNA-yW synthesizing protein 1 homolog B (S. cerevisiae)
Gene Name: TYW1B
Alternative Gene Name: LINC00069, MGC87315, NCRNA00069, RSAFD2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056310: 67%, ENSRNOG00000024352: 67%
Entrez Gene ID: 441250
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RVMSRGEGDCDVVKSKHGSIEANFRAWKTKFISQLQALQKGERKKSCGGHCKKGKCESHQHGSEEREEGSQEQDELHHR
Gene Sequence RVMSRGEGDCDVVKSKHGSIEANFRAWKTKFISQLQALQKGERKKSCGGHCKKGKCESHQHGSEEREEGSQEQDELHHR
Gene ID - Mouse ENSMUSG00000056310
Gene ID - Rat ENSRNOG00000024352
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TYW1B pAb (ATL-HPA047052)
Datasheet Anti TYW1B pAb (ATL-HPA047052) Datasheet (External Link)
Vendor Page Anti TYW1B pAb (ATL-HPA047052) at Atlas Antibodies

Documents & Links for Anti TYW1B pAb (ATL-HPA047052)
Datasheet Anti TYW1B pAb (ATL-HPA047052) Datasheet (External Link)
Vendor Page Anti TYW1B pAb (ATL-HPA047052)