Anti TYW1 pAb (ATL-HPA043136)

Atlas Antibodies

Catalog No.:
ATL-HPA043136-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: tRNA-yW synthesizing protein 1 homolog (S. cerevisiae)
Gene Name: TYW1
Alternative Gene Name: FLJ10900, MGC23001, MGC60291, RSAFD1, TYW1A, YPL207W
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056310: 85%, ENSRNOG00000024352: 86%
Entrez Gene ID: 55253
Uniprot ID: Q9NV66
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QCKISSFLVTNAQFPAEIRNLEPVTQLYVSVDASTKDSLKKIDRPLFKDFWQQFLDSLKALAVKQQRTVYR
Gene Sequence QCKISSFLVTNAQFPAEIRNLEPVTQLYVSVDASTKDSLKKIDRPLFKDFWQQFLDSLKALAVKQQRTVYR
Gene ID - Mouse ENSMUSG00000056310
Gene ID - Rat ENSRNOG00000024352
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TYW1 pAb (ATL-HPA043136)
Datasheet Anti TYW1 pAb (ATL-HPA043136) Datasheet (External Link)
Vendor Page Anti TYW1 pAb (ATL-HPA043136) at Atlas Antibodies

Documents & Links for Anti TYW1 pAb (ATL-HPA043136)
Datasheet Anti TYW1 pAb (ATL-HPA043136) Datasheet (External Link)
Vendor Page Anti TYW1 pAb (ATL-HPA043136)