Anti TYMP pAb (ATL-HPA001072 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA001072-25

Protein Description: thymidine phosphorylase
Gene Name: TYMP
Alternative Gene Name: ECGF1, MNGIE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022615: 77%, ENSRNOG00000032394: 78%
Entrez Gene ID: 1890
Uniprot ID: P19971
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EGSQGLPDPSPEPKQLPELIRMKRDGGRLSEADIRGFVAAVVNGSAQGAQIGAMLMAIRLRGMDLEETSVLTQALAQSGQQLEWPEAWRQQLVDKHSTGGVGDKVSLVLAPALAACGCKVPMISG
• Gene Sequence: EGSQGLPDPSPEPKQLPELIRMKRDGGRLSEADIRGFVAAVVNGSAQGAQIGAMLMAIRLRGMDLEETSVLTQALAQSGQQLEWPEAWRQQLVDKHSTGGVGDKVSLVLAPALAACGCKVPMISG
• Gene ID - Mouse: ENSMUSG00000022615
• Gene ID - Rat: ENSRNOG00000032394
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TYMP pAb (ATL-HPA001072 w/enhanced validation) – 2 Found

Kumar, Ghantasala S Sameer; Venugopal, Abhilash K; Kashyap, Manoj Kumar; Raju, Rajesh; Marimuthu, Arivusudar; Palapetta, Shyam Mohan; Subbanayya, Yashwanth; Goel, Renu; Chawla, Ankit; Dikshit, Jyoti Bajpai; Tata, Pramila; Harsha, H C; Maharudraiah, Jagadeesha; Ramachandra, Y L; Satishchandra, Parthasarathy; Prasad, T S Keshava; Pandey, Akhilesh; Mahadevan, Anita; Shankar, S K. Gene Expression Profiling of Tuberculous Meningitis Co-infected with HIV. Journal Of Proteomics & Bioinformatics. 2012;5(9):235-244. 

Harada, Suguru; Yanagisawa, Mieko; Kaneko, Saori; Yorozu, Keigo; Yamamoto, Kaname; Moriya, Yoichiro; Harada, Naoki. Superior antitumor activity of trastuzumab combined with capecitabine plus oxaliplatin in a human epidermal growth factor receptor 2-positive human gastric cancer xenograft model. Molecular And Clinical Oncology. 2015;3(5):987-994.