Anti TXNRD2 pAb (ATL-HPA003323)

Atlas Antibodies

Catalog No.: ATL-HPA003323-100

Protein Description: thioredoxin reductase 2
Gene Name: TXNRD2
Alternative Gene Name: TR, TR3, TRXR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000099282: 80%, ENSRNOG00000001890: 80%
Entrez Gene ID: 10587
Uniprot ID: Q9NNW7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CAGFLTGIGLDTTIMMRSIPLRGFDQQMSSMVIEHMASHGTRFLRGCAPSRVRRLPDGQLQVTWEDSTTGKEDTGTFDTVLWAIGRVPDTRSLNLEKAGVDTSPDTQKILVDSREATSVPHIYAIGDVVEGRPELTPTAIMAGRLLVQRLF
• Gene Sequence: CAGFLTGIGLDTTIMMRSIPLRGFDQQMSSMVIEHMASHGTRFLRGCAPSRVRRLPDGQLQVTWEDSTTGKEDTGTFDTVLWAIGRVPDTRSLNLEKAGVDTSPDTQKILVDSREATSVPHIYAIGDVVEGRPELTPTAIMAGRLLVQRLF
• Gene ID - Mouse: ENSMUSG00000099282
• Gene ID - Rat: ENSRNOG00000001890
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TXNRD2 pAb (ATL-HPA003323) – 7 Found

Sonet, Jordan; Mosca, Maurine; Bierla, Katarzyna; Modzelewska, Karolina; Flis-Borsuk, Anna; Suchocki, Piotr; Ksiazek, Iza; Anuszewska, Elzbieta; Bulteau, Anne-Laure; Szpunar, Joanna; Lobinski, Ryszard; Chavatte, Laurent. Selenized Plant Oil Is an Efficient Source of Selenium for Selenoprotein Biosynthesis in Human Cell Lines. Nutrients. 2019;11(7) 

Mita, Yuichiro; Uchida, Risa; Yasuhara, Sayuri; Kishi, Kohei; Hoshi, Takayuki; Matsuo, Yoshitaka; Yokooji, Tadashi; Shirakawa, Yoshino; Toyama, Takashi; Urano, Yasuomi; Inada, Toshifumi; Noguchi, Noriko; Saito, Yoshiro. Identification of a novel endogenous long non-coding RNA that inhibits selenoprotein P translation. Nucleic Acids Research. 2021;49(12):6893-6907. 

Wirth, Eva K; Conrad, Marcus; Winterer, Jochen; Wozny, Christian; Carlson, Bradley A; Roth, Stephan; Schmitz, Dietmar; Bornkamm, Georg W; Coppola, Vincenzo; Tessarollo, Lino; Schomburg, Lutz; Köhrle, Josef; Hatfield, Dolph L; Schweizer, Ulrich. Neuronal selenoprotein expression is required for interneuron development and prevents seizures and neurodegeneration. Faseb Journal : Official Publication Of The Federation Of American Societies For Experimental Biology. 2010;24(3):844-52. 

Dammeyer, Pascal; Arnér, Elias S J. Human Protein Atlas of redox systems - what can be learnt?. Biochimica Et Biophysica Acta. 2011;1810(1):111-38. 

Wirth, Eva K; Sheu, Sien-Yi; Chiu-Ugalde, Jazmin; Sapin, Remy; Klein, Marc O; Mossbrugger, Ilona; Quintanilla-Martinez, Leticia; de Angelis, Martin Hrabĕ; Krude, Heiko; Riebel, Thomas; Rothe, Karin; Köhrle, Josef; Schmid, Kurt W; Schweizer, Ulrich; Grüters, Annette. Monocarboxylate transporter 8 deficiency: altered thyroid morphology and persistent high triiodothyronine/thyroxine ratio after thyroidectomy. European Journal Of Endocrinology. 2011;165(4):555-61. 

Touat-Hamici, Zahia; Legrain, Yona; Bulteau, Anne-Laure; Chavatte, Laurent. Selective up-regulation of human selenoproteins in response to oxidative stress. The Journal Of Biological Chemistry. 2014;289(21):14750-61. 

Turnbull, Patrick C; Dehghani, Ali C; Theriau, Christopher F; Connor, Michael K; Perry, Christopher G R. Synergistic activation of mitochondrial metabolism and the glutathione redox couple protects HepG2 hepatocarcinoma cells from palmitoylcarnitine-induced stress. American Journal Of Physiology. Cell Physiology. 2019;317(6):C1324-C1329.