Anti TXNL4A pAb (ATL-HPA041324)

Atlas Antibodies

Catalog No.: ATL-HPA041324-25

Protein Description: thioredoxin-like 4A
Gene Name: TXNL4A
Alternative Gene Name: DIB1, DIM1, HsT161, SNRNP15, TXNL4, U5-15kD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057130: 100%, ENSRNOG00000052004: 100%
Entrez Gene ID: 10907
Uniprot ID: P83876
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNK
• Gene Sequence: MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNK
• Gene ID - Mouse: ENSMUSG00000057130
• Gene ID - Rat: ENSRNOG00000052004
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.