Anti TXNDC5 pAb (ATL-HPA034678 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA034678-25

Protein Description: thioredoxin domain containing 5 (endoplasmic reticulum)
Gene Name: TXNDC5
Alternative Gene Name: EndoPDI, ERp46, FLJ21353, FLJ90810, Hcc-2, MGC3178, PDIA15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038991: 79%, ENSRNOG00000013469: 80%
Entrez Gene ID: 81567
Uniprot ID: Q8NBS9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TQHYELCSGNQVRGYPTLLWFRDGKKVDQYKGKRDLESLREYVESQLQRTETGATETVTPSEAPVLAAEPEADKGTVLALTENNFD
• Gene Sequence: TQHYELCSGNQVRGYPTLLWFRDGKKVDQYKGKRDLESLREYVESQLQRTETGATETVTPSEAPVLAAEPEADKGTVLALTENNFD
• Gene ID - Mouse: ENSMUSG00000038991
• Gene ID - Rat: ENSRNOG00000013469
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.