Anti TXLNA pAb (ATL-HPA045383 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA045383-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: taxilin alpha
Gene Name: TXLNA
Alternative Gene Name: DKFZp451J0118
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053841: 60%, ENSRNOG00000048242: 65%
Entrez Gene ID: 200081
Uniprot ID: P40222
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RNDLNKRVQDLSAGGQGSLTDSGPERRPEGPGAQAPSSPRVTEAPCYPGAPSTE
Gene Sequence RNDLNKRVQDLSAGGQGSLTDSGPERRPEGPGAQAPSSPRVTEAPCYPGAPSTE
Gene ID - Mouse ENSMUSG00000053841
Gene ID - Rat ENSRNOG00000048242
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TXLNA pAb (ATL-HPA045383 w/enhanced validation)
Datasheet Anti TXLNA pAb (ATL-HPA045383 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TXLNA pAb (ATL-HPA045383 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TXLNA pAb (ATL-HPA045383 w/enhanced validation)
Datasheet Anti TXLNA pAb (ATL-HPA045383 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TXLNA pAb (ATL-HPA045383 w/enhanced validation)