Anti TWF2 pAb (ATL-HPA053874)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053874-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: TWF2
Alternative Gene Name: A6r, A6RP, PTK9L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023277: 94%, ENSRNOG00000048915: 94%
Entrez Gene ID: 11344
Uniprot ID: Q6IBS0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HQTGIHATEELKEFFAKARAGSVRLIKVVIEDEQLVLGASQEPVGRWDQDYDRAVLPLLDAQQPCYLLYR |
| Gene Sequence | HQTGIHATEELKEFFAKARAGSVRLIKVVIEDEQLVLGASQEPVGRWDQDYDRAVLPLLDAQQPCYLLYR |
| Gene ID - Mouse | ENSMUSG00000023277 |
| Gene ID - Rat | ENSRNOG00000048915 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TWF2 pAb (ATL-HPA053874) | |
| Datasheet | Anti TWF2 pAb (ATL-HPA053874) Datasheet (External Link) |
| Vendor Page | Anti TWF2 pAb (ATL-HPA053874) at Atlas Antibodies |
| Documents & Links for Anti TWF2 pAb (ATL-HPA053874) | |
| Datasheet | Anti TWF2 pAb (ATL-HPA053874) Datasheet (External Link) |
| Vendor Page | Anti TWF2 pAb (ATL-HPA053874) |