Anti TWF2 pAb (ATL-HPA053874)

Atlas Antibodies

Catalog No.:
ATL-HPA053874-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: twinfilin actin-binding protein 2
Gene Name: TWF2
Alternative Gene Name: A6r, A6RP, PTK9L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023277: 94%, ENSRNOG00000048915: 94%
Entrez Gene ID: 11344
Uniprot ID: Q6IBS0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HQTGIHATEELKEFFAKARAGSVRLIKVVIEDEQLVLGASQEPVGRWDQDYDRAVLPLLDAQQPCYLLYR
Gene Sequence HQTGIHATEELKEFFAKARAGSVRLIKVVIEDEQLVLGASQEPVGRWDQDYDRAVLPLLDAQQPCYLLYR
Gene ID - Mouse ENSMUSG00000023277
Gene ID - Rat ENSRNOG00000048915
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TWF2 pAb (ATL-HPA053874)
Datasheet Anti TWF2 pAb (ATL-HPA053874) Datasheet (External Link)
Vendor Page Anti TWF2 pAb (ATL-HPA053874) at Atlas Antibodies

Documents & Links for Anti TWF2 pAb (ATL-HPA053874)
Datasheet Anti TWF2 pAb (ATL-HPA053874) Datasheet (External Link)
Vendor Page Anti TWF2 pAb (ATL-HPA053874)