Anti TUBE1 pAb (ATL-HPA032073)
Atlas Antibodies
- Catalog No.:
- ATL-HPA032073-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: TUBE1
Alternative Gene Name: dJ142L7.2, FLJ22589, TUBE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019845: 93%, ENSRNOG00000000598: 92%
Entrez Gene ID: 51175
Uniprot ID: Q9UJT0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NMDLNEISMNLVPFPQLHYLVSSLTPLYTLTDVNIPPRRLDQMFSDAFSKDHQLLRADPKHSLYLACALMVRGNVQISDLRRNIERLKPSLQFVS |
| Gene Sequence | NMDLNEISMNLVPFPQLHYLVSSLTPLYTLTDVNIPPRRLDQMFSDAFSKDHQLLRADPKHSLYLACALMVRGNVQISDLRRNIERLKPSLQFVS |
| Gene ID - Mouse | ENSMUSG00000019845 |
| Gene ID - Rat | ENSRNOG00000000598 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TUBE1 pAb (ATL-HPA032073) | |
| Datasheet | Anti TUBE1 pAb (ATL-HPA032073) Datasheet (External Link) |
| Vendor Page | Anti TUBE1 pAb (ATL-HPA032073) at Atlas Antibodies |
| Documents & Links for Anti TUBE1 pAb (ATL-HPA032073) | |
| Datasheet | Anti TUBE1 pAb (ATL-HPA032073) Datasheet (External Link) |
| Vendor Page | Anti TUBE1 pAb (ATL-HPA032073) |