Anti TUBD1 pAb (ATL-HPA027090)

Atlas Antibodies

Catalog No.:
ATL-HPA027090-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: tubulin, delta 1
Gene Name: TUBD1
Alternative Gene Name: FLJ12709, TUBD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020513: 83%, ENSRNOG00000053309: 84%
Entrez Gene ID: 51174
Uniprot ID: Q9UJT1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FDALLSDSHSSQGLCSMRENEAYQASCKERFFSEEENGVPIARAVLVDMEPKVINQMLSKAAQSGQWKYGQHACFCQ
Gene Sequence FDALLSDSHSSQGLCSMRENEAYQASCKERFFSEEENGVPIARAVLVDMEPKVINQMLSKAAQSGQWKYGQHACFCQ
Gene ID - Mouse ENSMUSG00000020513
Gene ID - Rat ENSRNOG00000053309
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TUBD1 pAb (ATL-HPA027090)
Datasheet Anti TUBD1 pAb (ATL-HPA027090) Datasheet (External Link)
Vendor Page Anti TUBD1 pAb (ATL-HPA027090) at Atlas Antibodies

Documents & Links for Anti TUBD1 pAb (ATL-HPA027090)
Datasheet Anti TUBD1 pAb (ATL-HPA027090) Datasheet (External Link)
Vendor Page Anti TUBD1 pAb (ATL-HPA027090)