Anti TUBD1 pAb (ATL-HPA027090)
Atlas Antibodies
- Catalog No.:
- ATL-HPA027090-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: TUBD1
Alternative Gene Name: FLJ12709, TUBD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020513: 83%, ENSRNOG00000053309: 84%
Entrez Gene ID: 51174
Uniprot ID: Q9UJT1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FDALLSDSHSSQGLCSMRENEAYQASCKERFFSEEENGVPIARAVLVDMEPKVINQMLSKAAQSGQWKYGQHACFCQ |
| Gene Sequence | FDALLSDSHSSQGLCSMRENEAYQASCKERFFSEEENGVPIARAVLVDMEPKVINQMLSKAAQSGQWKYGQHACFCQ |
| Gene ID - Mouse | ENSMUSG00000020513 |
| Gene ID - Rat | ENSRNOG00000053309 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TUBD1 pAb (ATL-HPA027090) | |
| Datasheet | Anti TUBD1 pAb (ATL-HPA027090) Datasheet (External Link) |
| Vendor Page | Anti TUBD1 pAb (ATL-HPA027090) at Atlas Antibodies |
| Documents & Links for Anti TUBD1 pAb (ATL-HPA027090) | |
| Datasheet | Anti TUBD1 pAb (ATL-HPA027090) Datasheet (External Link) |
| Vendor Page | Anti TUBD1 pAb (ATL-HPA027090) |