Anti TUBD1 pAb (ATL-HPA023980)
Atlas Antibodies
- Catalog No.:
- ATL-HPA023980-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: TUBD1
Alternative Gene Name: FLJ12709, TUBD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020513: 87%, ENSRNOG00000053309: 63%
Entrez Gene ID: 51174
Uniprot ID: Q9UJT1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VFQPTYSAESSFHYRRNPLGDLMEHLVPHPEFKMLSVRNIPHMSENSLAYTTFTWAGLLKHLRQMLISNAKMEEGID |
| Gene Sequence | VFQPTYSAESSFHYRRNPLGDLMEHLVPHPEFKMLSVRNIPHMSENSLAYTTFTWAGLLKHLRQMLISNAKMEEGID |
| Gene ID - Mouse | ENSMUSG00000020513 |
| Gene ID - Rat | ENSRNOG00000053309 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TUBD1 pAb (ATL-HPA023980) | |
| Datasheet | Anti TUBD1 pAb (ATL-HPA023980) Datasheet (External Link) |
| Vendor Page | Anti TUBD1 pAb (ATL-HPA023980) at Atlas Antibodies |
| Documents & Links for Anti TUBD1 pAb (ATL-HPA023980) | |
| Datasheet | Anti TUBD1 pAb (ATL-HPA023980) Datasheet (External Link) |
| Vendor Page | Anti TUBD1 pAb (ATL-HPA023980) |
| Citations for Anti TUBD1 pAb (ATL-HPA023980) – 1 Found |
| Dunleavy, Jessica E M; Okuda, Hidenobu; O'Connor, Anne E; Merriner, D Jo; O'Donnell, Liza; Jamsai, Duangporn; Bergmann, Martin; O'Bryan, Moira K. Katanin-like 2 (KATNAL2) functions in multiple aspects of haploid male germ cell development in the mouse. Plos Genetics. 2017;13(11):e1007078. PubMed |