Anti TTC29 pAb (ATL-HPA061473)

Atlas Antibodies

Catalog No.: ATL-HPA061473-25

Protein Description: tetratricopeptide repeat domain 29
Gene Name: TTC29
Alternative Gene Name: NYD-SP14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037101: 83%, ENSRNOG00000012342: 83%
Entrez Gene ID: 83894
Uniprot ID: Q8NA56
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MTRPKLTALARQKLPCSSRKIPRSQLIKEKDDIDHYLEVNFKGLSKEEVAAYRNSYKKNICVDMLRDGYHKSFTELFALMERWD
• Gene Sequence: MTRPKLTALARQKLPCSSRKIPRSQLIKEKDDIDHYLEVNFKGLSKEEVAAYRNSYKKNICVDMLRDGYHKSFTELFALMERWD
• Gene ID - Mouse: ENSMUSG00000037101
• Gene ID - Rat: ENSRNOG00000012342
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TTC29 pAb (ATL-HPA061473) – 1 Found

Dai, Siyu; Liang, Yan; Liu, Mohan; Yang, Yanting; Liu, Hongqian; Shen, Ying. Novel biallelic mutations in TTC29 cause asthenoteratospermia and male infertility. Molecular Genetics & Genomic Medicine. 2022;10(12):e2078.