Anti TTC29 pAb (ATL-HPA061473)

Atlas Antibodies

Catalog No.:
ATL-HPA061473-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: tetratricopeptide repeat domain 29
Gene Name: TTC29
Alternative Gene Name: NYD-SP14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037101: 83%, ENSRNOG00000012342: 83%
Entrez Gene ID: 83894
Uniprot ID: Q8NA56
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MTRPKLTALARQKLPCSSRKIPRSQLIKEKDDIDHYLEVNFKGLSKEEVAAYRNSYKKNICVDMLRDGYHKSFTELFALMERWD
Gene Sequence MTRPKLTALARQKLPCSSRKIPRSQLIKEKDDIDHYLEVNFKGLSKEEVAAYRNSYKKNICVDMLRDGYHKSFTELFALMERWD
Gene ID - Mouse ENSMUSG00000037101
Gene ID - Rat ENSRNOG00000012342
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TTC29 pAb (ATL-HPA061473)
Datasheet Anti TTC29 pAb (ATL-HPA061473) Datasheet (External Link)
Vendor Page Anti TTC29 pAb (ATL-HPA061473) at Atlas Antibodies

Documents & Links for Anti TTC29 pAb (ATL-HPA061473)
Datasheet Anti TTC29 pAb (ATL-HPA061473) Datasheet (External Link)
Vendor Page Anti TTC29 pAb (ATL-HPA061473)
Citations for Anti TTC29 pAb (ATL-HPA061473) – 1 Found
Dai, Siyu; Liang, Yan; Liu, Mohan; Yang, Yanting; Liu, Hongqian; Shen, Ying. Novel biallelic mutations in TTC29 cause asthenoteratospermia and male infertility. Molecular Genetics & Genomic Medicine. 2022;10(12):e2078.  PubMed