Anti TTBK2 pAb (ATL-HPA018113 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA018113-25

Protein Description: tau tubulin kinase 2
Gene Name: TTBK2
Alternative Gene Name: KIAA0847, SCA11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090100: 74%, ENSRNOG00000011059: 78%
Entrez Gene ID: 146057
Uniprot ID: Q6IQ55
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TTEPLDVTKTQTFSVVPNQDKNNEIMKLLTVGTSEISSRDIDPHVEGQIGQVAEMQKNKISKDDDIMSEDLPGHQGDLSTFLHQEGKREKITPRNGELFHCVS
• Gene Sequence: TTEPLDVTKTQTFSVVPNQDKNNEIMKLLTVGTSEISSRDIDPHVEGQIGQVAEMQKNKISKDDDIMSEDLPGHQGDLSTFLHQEGKREKITPRNGELFHCVS
• Gene ID - Mouse: ENSMUSG00000090100
• Gene ID - Rat: ENSRNOG00000011059
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TTBK2 pAb (ATL-HPA018113 w/enhanced validation) – 18 Found

Xu, Qingwen; Zhang, Yuxia; Wei, Qing; Huang, Yan; Hu, Jinghua; Ling, Kun. Phosphatidylinositol phosphate kinase PIPKIγ and phosphatase INPP5E coordinate initiation of ciliogenesis. Nature Communications. 2016;7( 26916822):10777. 

Loukil, Abdelhalim; Tormanen, Kati; Sütterlin, Christine. The daughter centriole controls ciliogenesis by regulating Neurl-4 localization at the centrosome. The Journal Of Cell Biology. 2017;216(5):1287-1300. 

Weng, Rueyhung Roc; Yang, T Tony; Huang, Chia-En; Chang, Chih-Wei; Wang, Won-Jing; Liao, Jung-Chi. Super-Resolution Imaging Reveals TCTN2 Depletion-Induced IFT88 Lumen Leakage and Ciliary Weakening. Biophysical Journal. 2018;115(2):263-275. 

Bowler, Mathew; Kong, Dong; Sun, Shufeng; Nanjundappa, Rashmi; Evans, Lauren; Farmer, Veronica; Holland, Andrew; Mahjoub, Moe R; Sui, Haixin; Loncarek, Jadranka. High-resolution characterization of centriole distal appendage morphology and dynamics by correlative STORM and electron microscopy. Nature Communications. 2019;10(1):993. 

Chen, Ting-Yu; Huang, Bu-Miin; Tang, Tang K; Chao, Yu-Ying; Xiao, Xiao-Yi; Lee, Pei-Rong; Yang, Li-Yun; Wang, Chia-Yih. Genotoxic stress-activated DNA-PK-p53 cascade and autophagy cooperatively induce ciliogenesis to maintain the DNA damage response. Cell Death And Differentiation. 2021;28(6):1865-1879. 

Chen, Chuan; Xu, Qingwen; Zhang, Yuxia; Davies, Brian A; Huang, Yan; Katzmann, David J; Harris, Peter C; Hu, Jinghua; Ling, Kun. Ciliopathy protein HYLS1 coordinates the biogenesis and signaling of primary cilia by activating the ciliary lipid kinase PIPKIγ. Science Advances. 2021;7(26) 

Čajánek, Lukáš; Nigg, Erich A. Cep164 triggers ciliogenesis by recruiting Tau tubulin kinase 2 to the mother centriole. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2014;111(28):E2841-50. 

Bangs, Fiona K; Schrode, Nadine; Hadjantonakis, Anna-Katerina; Anderson, Kathryn V. Lineage specificity of primary cilia in the mouse embryo. Nature Cell Biology. 2015;17(2):113-22. 

Gholkar, Ankur A; Senese, Silvia; Lo, Yu-Chen; Capri, Joseph; Deardorff, William J; Dharmarajan, Harish; Contreras, Ely; Hodara, Emmanuelle; Whitelegge, Julian P; Jackson, Peter K; Torres, Jorge Z. Tctex1d2 associates with short-rib polydactyly syndrome proteins and is required for ciliogenesis. Cell Cycle (Georgetown, Tex.). 14(7):1116-25. 

Wang, Lei; Failler, Marion; Fu, Wenxiang; Dynlacht, Brian D. A distal centriolar protein network controls organelle maturation and asymmetry. Nature Communications. 2018;9(1):3938. 

Lo, Chien-Hui; Lin, I-Hsuan; Yang, T Tony; Huang, Yen-Chun; Tanos, Barbara E; Chou, Po-Chun; Chang, Chih-Wei; Tsay, Yeou-Guang; Liao, Jung-Chi; Wang, Won-Jing. Phosphorylation of CEP83 by TTBK2 is necessary for cilia initiation. The Journal Of Cell Biology. 2019;218(10):3489-3505. 

Hanáková, Kateřina; Bernatík, Ondřej; Kravec, Marek; Micka, Miroslav; Kumar, Jitender; Harnoš, Jakub; Ovesná, Petra; Paclíková, Petra; Rádsetoulal, Matěj; Potěšil, David; Tripsianes, Konstantinos; Čajánek, Lukáš; Zdráhal, Zbyněk; Bryja, Vítězslav. Comparative phosphorylation map of Dishevelled 3 links phospho-signatures to biological outputs. Cell Communication And Signaling : Ccs. 2019;17(1):170. 

Fan, Jia-Rong; You, Li-Ru; Wang, Won-Jing; Huang, Wei-Syun; Chu, Ching-Tung; Chi, Ya-Hui; Chen, Hong-Chen. Lamin A-mediated nuclear lamina integrity is required for proper ciliogenesis. Embo Reports. 2020;21(10):e49680. 

Kobayashi, Tetsuo; Tanaka, Kosuke; Mashima, Yu; Shoda, Ayano; Tokuda, Mio; Itoh, Hiroshi. CEP164 Deficiency Causes Hyperproliferation of Pancreatic Cancer Cells. Frontiers In Cell And Developmental Biology. 8( 33251215):587691. 

Bernatik, Ondrej; Paclikova, Petra; Kotrbova, Anna; Bryja, Vitezslav; Cajanek, Lukas. Primary Cilia Formation Does Not Rely on WNT/β-Catenin Signaling. Frontiers In Cell And Developmental Biology. 9( 33718363):623753. 

Sobu, Yuriko; Wawro, Paulina S; Dhekne, Herschel S; Yeshaw, Wondwossen M; Pfeffer, Suzanne R. Pathogenic LRRK2 regulates ciliation probability upstream of tau tubulin kinase 2 via Rab10 and RILPL1 proteins. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2021;118(10) 

Shen, Xiao-Lin; Yuan, Jin-Feng; Qin, Xuan-He; Song, Guang-Ping; Hu, Huai-Bin; Tu, Hai-Qing; Song, Zeng-Qing; Li, Pei-Yao; Xu, Yu-Ling; Li, Sen; Jian, Xiao-Xiao; Li, Jia-Ning; He, Chun-Yu; Yu, Xi-Ping; Liang, Li-Yun; Wu, Min; Han, Qiu-Ying; Wang, Kai; Li, Ai-Ling; Zhou, Tao; Zhang, Yu-Cheng; Wang, Na; Li, Hui-Yan. LUBAC regulates ciliogenesis by promoting CP110 removal from the mother centriole. The Journal Of Cell Biology. 2022;221(1) 

Hall, Emma A; Kumar, Dhivya; Prosser, Suzanna L; Yeyati, Patricia L; Herranz-Pérez, Vicente; García-Verdugo, Jose Manuel; Rose, Lorraine; McKie, Lisa; Dodd, Daniel O; Tennant, Peter A; Megaw, Roly; Murphy, Laura C; Ferreira, Marisa F; Grimes, Graeme; Williams, Lucy; Quidwai, Tooba; Pelletier, Laurence; Reiter, Jeremy F; Mill, Pleasantine. Centriolar satellites expedite mother centriole remodeling to promote ciliogenesis. Elife. 2023;12( 36790165)