Anti TSR3 pAb (ATL-HPA046265)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046265-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: TSR3
Alternative Gene Name: C16orf42, MGC24381
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015126: 68%, ENSRNOG00000017858: 74%
Entrez Gene ID: 115939
Uniprot ID: Q9UJK0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FLANAKESPQEEEIDPFDVDSGREFGNPNRPVASTRLPSDTDDSDASEDP |
Gene Sequence | FLANAKESPQEEEIDPFDVDSGREFGNPNRPVASTRLPSDTDDSDASEDP |
Gene ID - Mouse | ENSMUSG00000015126 |
Gene ID - Rat | ENSRNOG00000017858 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TSR3 pAb (ATL-HPA046265) | |
Datasheet | Anti TSR3 pAb (ATL-HPA046265) Datasheet (External Link) |
Vendor Page | Anti TSR3 pAb (ATL-HPA046265) at Atlas Antibodies |
Documents & Links for Anti TSR3 pAb (ATL-HPA046265) | |
Datasheet | Anti TSR3 pAb (ATL-HPA046265) Datasheet (External Link) |
Vendor Page | Anti TSR3 pAb (ATL-HPA046265) |