Anti TSPAN8 pAb (ATL-HPA022273)

Atlas Antibodies

Catalog No.:
ATL-HPA022273-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: tetraspanin 8
Gene Name: TSPAN8
Alternative Gene Name: CO-029, TM4SF3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034127: 60%, ENSRNOG00000004411: 59%
Entrez Gene ID: 7103
Uniprot ID: P19075
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVY
Gene Sequence IVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVY
Gene ID - Mouse ENSMUSG00000034127
Gene ID - Rat ENSRNOG00000004411
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TSPAN8 pAb (ATL-HPA022273)
Datasheet Anti TSPAN8 pAb (ATL-HPA022273) Datasheet (External Link)
Vendor Page Anti TSPAN8 pAb (ATL-HPA022273) at Atlas Antibodies

Documents & Links for Anti TSPAN8 pAb (ATL-HPA022273)
Datasheet Anti TSPAN8 pAb (ATL-HPA022273) Datasheet (External Link)
Vendor Page Anti TSPAN8 pAb (ATL-HPA022273)