Anti TSKU pAb (ATL-HPA008164 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA008164-25

Protein Description: tsukushi, small leucine rich proteoglycan
Gene Name: TSKU
Alternative Gene Name: E2IG4, LRRC54, TSK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049580: 92%, ENSRNOG00000027784: 93%
Entrez Gene ID: 25987
Uniprot ID: Q8WUA8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DTAHLDLSSNRLEMVNESVLAGPGYTTLAGLDLSHNLLTSISPTAFSRLRYLESLDLSHNGLTALPAESFTSSPLSDVNLSHNQLREVSVSAFTTHSQGRALHVDLSHNLIHR
• Gene Sequence: DTAHLDLSSNRLEMVNESVLAGPGYTTLAGLDLSHNLLTSISPTAFSRLRYLESLDLSHNGLTALPAESFTSSPLSDVNLSHNQLREVSVSAFTTHSQGRALHVDLSHNLIHR
• Gene ID - Mouse: ENSMUSG00000049580
• Gene ID - Rat: ENSRNOG00000027784
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TSKU pAb (ATL-HPA008164 w/enhanced validation) – 1 Found

Henke, Alexander; Grace, O Cathal; Ashley, George R; Stewart, Grant D; Riddick, Antony C P; Yeun, Henry; O'Donnell, Marie; Anderson, Richard A; Thomson, Axel A. Stromal expression of decorin, Semaphorin6D, SPARC, Sprouty1 and Tsukushi in developing prostate and decreased levels of decorin in prostate cancer. Plos One. 7(8):e42516.