Anti TSHZ3 pAb (ATL-HPA008834)

Atlas Antibodies

Catalog No.: ATL-HPA008834-25

Protein Description: teashirt zinc finger homeobox 3
Gene Name: TSHZ3
Alternative Gene Name: KIAA1474, TSH3, ZNF537
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021217: 89%, ENSRNOG00000013938: 88%
Entrez Gene ID: 57616
Uniprot ID: Q63HK5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TNFHAMEELVKKVTEKVAKVEEKMKEPDGKLSPPKRATPSPCSSEVGEPIKMEASSDGGFRSQENSPSPPRDGCKDGSPLAEPVENGKELVKPLASSLSGSTAIITDHP
• Gene Sequence: TNFHAMEELVKKVTEKVAKVEEKMKEPDGKLSPPKRATPSPCSSEVGEPIKMEASSDGGFRSQENSPSPPRDGCKDGSPLAEPVENGKELVKPLASSLSGSTAIITDHP
• Gene ID - Mouse: ENSMUSG00000021217
• Gene ID - Rat: ENSRNOG00000013938
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TSHZ3 pAb (ATL-HPA008834) – 1 Found

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.