Anti TSHZ3 pAb (ATL-HPA008834)
Atlas Antibodies
- Catalog No.:
- ATL-HPA008834-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: TSHZ3
Alternative Gene Name: KIAA1474, TSH3, ZNF537
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021217: 89%, ENSRNOG00000013938: 88%
Entrez Gene ID: 57616
Uniprot ID: Q63HK5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TNFHAMEELVKKVTEKVAKVEEKMKEPDGKLSPPKRATPSPCSSEVGEPIKMEASSDGGFRSQENSPSPPRDGCKDGSPLAEPVENGKELVKPLASSLSGSTAIITDHP |
| Gene Sequence | TNFHAMEELVKKVTEKVAKVEEKMKEPDGKLSPPKRATPSPCSSEVGEPIKMEASSDGGFRSQENSPSPPRDGCKDGSPLAEPVENGKELVKPLASSLSGSTAIITDHP |
| Gene ID - Mouse | ENSMUSG00000021217 |
| Gene ID - Rat | ENSRNOG00000013938 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TSHZ3 pAb (ATL-HPA008834) | |
| Datasheet | Anti TSHZ3 pAb (ATL-HPA008834) Datasheet (External Link) |
| Vendor Page | Anti TSHZ3 pAb (ATL-HPA008834) at Atlas Antibodies |
| Documents & Links for Anti TSHZ3 pAb (ATL-HPA008834) | |
| Datasheet | Anti TSHZ3 pAb (ATL-HPA008834) Datasheet (External Link) |
| Vendor Page | Anti TSHZ3 pAb (ATL-HPA008834) |
| Citations for Anti TSHZ3 pAb (ATL-HPA008834) – 1 Found |
| Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed |