Anti TSHZ2 pAb (ATL-HPA038123)

Atlas Antibodies

SKU:
ATL-HPA038123-25
  • Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neurons.
  • Immunofluorescent staining of human cell line SiHa shows localization to the Golgi apparatus.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: teashirt zinc finger homeobox 2
Gene Name: TSHZ2
Alternative Gene Name: C20orf17, OVC10-2, TSH2, ZABC2, ZNF218
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047907: 89%, ENSRNOG00000048433: 90%
Entrez Gene ID: 128553
Uniprot ID: Q9NRE2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence SGSVAQLQGGNDTGTDEELETGPEQKGCFSYQNSPGSHLSNQDAENESLLSDASDQVSDIKSVCGRDASDKKAHTHVRLPNEAHNCMDKMTAVYANILSDSYWSGLGLGFKLSNSERRNCDTRNGSNKSDFDWHQDALSK
Gene ID - Mouse ENSMUSG00000047907
Gene ID - Rat ENSMUSG00000047907
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TSHZ2 pAb (ATL-HPA038123)
Datasheet Anti TSHZ2 pAb (ATL-HPA038123) Datasheet (External Link)
Vendor Page Anti TSHZ2 pAb (ATL-HPA038123) at Atlas Antibodies

Documents & Links for Anti TSHZ2 pAb (ATL-HPA038123)
Datasheet Anti TSHZ2 pAb (ATL-HPA038123) Datasheet (External Link)
Vendor Page Anti TSHZ2 pAb (ATL-HPA038123)