Anti TSC22D3 pAb (ATL-HPA001916)

Atlas Antibodies

Catalog No.: ATL-HPA001916-25

Protein Description: TSC22 domain family, member 3
Gene Name: TSC22D3
Alternative Gene Name: DIP, DSIPI, GILZ, hDIP, TSC-22R
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031431: 85%, ENSRNOG00000060899: 91%
Entrez Gene ID: 1831
Uniprot ID: Q99576
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAQSKLDCRSPVGLDCCNCCLDLAHRSGLQRGSSGENNNPGSPTVSNFRQLQEKLVFENLNTDKLNSIMRQDSLEPVLRDPCYLINEGICNRNIDQTMLSILLFFH
• Gene Sequence: MAQSKLDCRSPVGLDCCNCCLDLAHRSGLQRGSSGENNNPGSPTVSNFRQLQEKLVFENLNTDKLNSIMRQDSLEPVLRDPCYLINEGICNRNIDQTMLSILLFFH
• Gene ID - Mouse: ENSMUSG00000031431
• Gene ID - Rat: ENSRNOG00000060899
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.