Anti TRPV2 pAb (ATL-HPA044993)
Atlas Antibodies
- Catalog No.:
- ATL-HPA044993-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: TRPV2
Alternative Gene Name: VRL, VRL-1, VRL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018507: 71%, ENSRNOG00000003104: 59%
Entrez Gene ID: 51393
Uniprot ID: Q9Y5S1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RGKLDFGSGLPPMESQFQGEDRKFAPQIRVNLNYRKGTGASQPDPNRFDRDRLFNAVSRGVPEDLAGLPEYLSKTSKYLTDS |
| Gene Sequence | RGKLDFGSGLPPMESQFQGEDRKFAPQIRVNLNYRKGTGASQPDPNRFDRDRLFNAVSRGVPEDLAGLPEYLSKTSKYLTDS |
| Gene ID - Mouse | ENSMUSG00000018507 |
| Gene ID - Rat | ENSRNOG00000003104 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TRPV2 pAb (ATL-HPA044993) | |
| Datasheet | Anti TRPV2 pAb (ATL-HPA044993) Datasheet (External Link) |
| Vendor Page | Anti TRPV2 pAb (ATL-HPA044993) at Atlas Antibodies |
| Documents & Links for Anti TRPV2 pAb (ATL-HPA044993) | |
| Datasheet | Anti TRPV2 pAb (ATL-HPA044993) Datasheet (External Link) |
| Vendor Page | Anti TRPV2 pAb (ATL-HPA044993) |
| Citations for Anti TRPV2 pAb (ATL-HPA044993) – 3 Found |
| Elbaz, Mohamad; Ahirwar, Dinesh; Xiaoli, Zhang; Zhou, Xinyu; Lustberg, Maryam; Nasser, Mohd W; Shilo, Konstantin; Ganju, Ramesh K. TRPV2 is a novel biomarker and therapeutic target in triple negative breast cancer. Oncotarget. 2018;9(71):33459-33470. PubMed |
| Eubler, Katja; Herrmann, Carola; Tiefenbacher, Astrid; Köhn, Frank-Michael; Schwarzer, J Ullrich; Kunz, Lars; Mayerhofer, Artur. Ca(2+) Signaling and IL-8 Secretion in Human Testicular Peritubular Cells Involve the Cation Channel TRPV2. International Journal Of Molecular Sciences. 2018;19(9) PubMed |
| Eubler, Katja; Rantakari, Pia; Gerke, Heidi; Herrmann, Carola; Missel, Annika; Schmid, Nina; Walenta, Lena; Lahiri, Shibojyoti; Imhof, Axel; Strauss, Leena; Poutanen, Matti; Mayerhofer, Artur. Exploring the Ion Channel TRPV2 and Testicular Macrophages in Mouse Testis. International Journal Of Molecular Sciences. 2021;22(9) PubMed |