Anti TRPM4 pAb (ATL-HPA041169 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA041169-25

Protein Description: transient receptor potential cation channel, subfamily M, member 4
Gene Name: TRPM4
Alternative Gene Name: FLJ20041
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038260: 93%, ENSRNOG00000020714: 91%
Entrez Gene ID: 54795
Uniprot ID: Q8TD43
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GTGIDIPVLLLLIDGDEKMLTRIENATQAQLPCLLVAGSGGAADCLAETLEDTLAPGSGGARQGEARDRIRRFFPKGDLEVLQAQVERIMTRKE
• Gene Sequence: GTGIDIPVLLLLIDGDEKMLTRIENATQAQLPCLLVAGSGGAADCLAETLEDTLAPGSGGARQGEARDRIRRFFPKGDLEVLQAQVERIMTRKE
• Gene ID - Mouse: ENSMUSG00000038260
• Gene ID - Rat: ENSRNOG00000020714
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TRPM4 pAb (ATL-HPA041169 w/enhanced validation) – 1 Found

Wong, Kah Keng; Hussain, Faezahtul Arbaeyah. TRPM4 is overexpressed in breast cancer associated with estrogen response and epithelial-mesenchymal transition gene sets. Plos One. 15(6):e0233884.