Anti TRNAU1AP pAb (ATL-HPA032068)

Atlas Antibodies

Catalog No.:
ATL-HPA032068-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: tRNA selenocysteine 1 associated protein 1
Gene Name: TRNAU1AP
Alternative Gene Name: FLJ20503, SECP43, TRSPAP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028898: 100%, ENSRNOG00000055344: 100%
Entrez Gene ID: 54952
Uniprot ID: Q9NX07
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WMGDLEPYMDENFISRAFATMGETVMSVKIIRNRLTGIPAGYCFVEFADLATAEKCLHKINGKPLPGATP
Gene Sequence WMGDLEPYMDENFISRAFATMGETVMSVKIIRNRLTGIPAGYCFVEFADLATAEKCLHKINGKPLPGATP
Gene ID - Mouse ENSMUSG00000028898
Gene ID - Rat ENSRNOG00000055344
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TRNAU1AP pAb (ATL-HPA032068)
Datasheet Anti TRNAU1AP pAb (ATL-HPA032068) Datasheet (External Link)
Vendor Page Anti TRNAU1AP pAb (ATL-HPA032068) at Atlas Antibodies

Documents & Links for Anti TRNAU1AP pAb (ATL-HPA032068)
Datasheet Anti TRNAU1AP pAb (ATL-HPA032068) Datasheet (External Link)
Vendor Page Anti TRNAU1AP pAb (ATL-HPA032068)