Anti TRMT44 pAb (ATL-HPA045461)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045461-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: TRMT44
Alternative Gene Name: C4orf23, FLJ35725, METTL19, TRM44
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029097: 73%, ENSRNOG00000008898: 72%
Entrez Gene ID: 152992
Uniprot ID: Q8IYL2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ETLRRLKRECGGLQTLLRNSHQVFQVVNGRVHIRDWREETLWKTKQPEAKQRLLSEACKTRLCWFFMHHPDGCALSTDCCPFAHGPAEL |
| Gene Sequence | ETLRRLKRECGGLQTLLRNSHQVFQVVNGRVHIRDWREETLWKTKQPEAKQRLLSEACKTRLCWFFMHHPDGCALSTDCCPFAHGPAEL |
| Gene ID - Mouse | ENSMUSG00000029097 |
| Gene ID - Rat | ENSRNOG00000008898 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TRMT44 pAb (ATL-HPA045461) | |
| Datasheet | Anti TRMT44 pAb (ATL-HPA045461) Datasheet (External Link) |
| Vendor Page | Anti TRMT44 pAb (ATL-HPA045461) at Atlas Antibodies |
| Documents & Links for Anti TRMT44 pAb (ATL-HPA045461) | |
| Datasheet | Anti TRMT44 pAb (ATL-HPA045461) Datasheet (External Link) |
| Vendor Page | Anti TRMT44 pAb (ATL-HPA045461) |