Anti TRMT44 pAb (ATL-HPA045461)

Atlas Antibodies

Catalog No.:
ATL-HPA045461-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: tRNA methyltransferase 44 homolog (S. cerevisiae)
Gene Name: TRMT44
Alternative Gene Name: C4orf23, FLJ35725, METTL19, TRM44
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029097: 73%, ENSRNOG00000008898: 72%
Entrez Gene ID: 152992
Uniprot ID: Q8IYL2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ETLRRLKRECGGLQTLLRNSHQVFQVVNGRVHIRDWREETLWKTKQPEAKQRLLSEACKTRLCWFFMHHPDGCALSTDCCPFAHGPAEL
Gene Sequence ETLRRLKRECGGLQTLLRNSHQVFQVVNGRVHIRDWREETLWKTKQPEAKQRLLSEACKTRLCWFFMHHPDGCALSTDCCPFAHGPAEL
Gene ID - Mouse ENSMUSG00000029097
Gene ID - Rat ENSRNOG00000008898
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TRMT44 pAb (ATL-HPA045461)
Datasheet Anti TRMT44 pAb (ATL-HPA045461) Datasheet (External Link)
Vendor Page Anti TRMT44 pAb (ATL-HPA045461) at Atlas Antibodies

Documents & Links for Anti TRMT44 pAb (ATL-HPA045461)
Datasheet Anti TRMT44 pAb (ATL-HPA045461) Datasheet (External Link)
Vendor Page Anti TRMT44 pAb (ATL-HPA045461)