Anti TRMT10A pAb (ATL-HPA047601)

Atlas Antibodies

SKU:
ATL-HPA047601-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: tRNA methyltransferase 10 homolog A (S. cerevisiae)
Gene Name: TRMT10A
Alternative Gene Name: MGC27034, RG9MTD2, TRM10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004127: 87%, ENSRNOG00000011025: 87%
Entrez Gene ID: 93587
Uniprot ID: Q8TBZ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CQMEPNSDGHDRKRVRRDVVHSTLRLIIDCSFDHLMVLKDIKKLHKQIQRCYAENRRALHPVQFYLTSHGGQLKKNMDENDKGWVNW
Gene Sequence CQMEPNSDGHDRKRVRRDVVHSTLRLIIDCSFDHLMVLKDIKKLHKQIQRCYAENRRALHPVQFYLTSHGGQLKKNMDENDKGWVNW
Gene ID - Mouse ENSMUSG00000004127
Gene ID - Rat ENSRNOG00000011025
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TRMT10A pAb (ATL-HPA047601)
Datasheet Anti TRMT10A pAb (ATL-HPA047601) Datasheet (External Link)
Vendor Page Anti TRMT10A pAb (ATL-HPA047601) at Atlas Antibodies

Documents & Links for Anti TRMT10A pAb (ATL-HPA047601)
Datasheet Anti TRMT10A pAb (ATL-HPA047601) Datasheet (External Link)
Vendor Page Anti TRMT10A pAb (ATL-HPA047601)