Anti TRIO pAb (ATL-HPA008157 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA008157-25

Protein Description: trio Rho guanine nucleotide exchange factor
Gene Name: TRIO
Alternative Gene Name: ARHGEF23
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022263: 97%, ENSRNOG00000012148: 96%
Entrez Gene ID: 7204
Uniprot ID: O75962
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MLVTHDYTAVKEDEINVYQGEVVQILASNQQNMFLVFRAATDQCPAAEGWIPGFVLGHTSAVIVENPDGTLKKSTSWHTALRLRKKSEKKDKDGKREGKLENGYRKSREGLSNKVSVKLLNPN
• Gene Sequence: MLVTHDYTAVKEDEINVYQGEVVQILASNQQNMFLVFRAATDQCPAAEGWIPGFVLGHTSAVIVENPDGTLKKSTSWHTALRLRKKSEKKDKDGKREGKLENGYRKSREGLSNKVSVKLLNPN
• Gene ID - Mouse: ENSMUSG00000022263
• Gene ID - Rat: ENSRNOG00000012148
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TRIO pAb (ATL-HPA008157 w/enhanced validation) – 1 Found

Engqvist, Hanna; Parris, Toshima Z; Kovács, Anikó; Nemes, Szilárd; Werner Rönnerman, Elisabeth; De Lara, Shahin; Biermann, Jana; Sundfeldt, Karin; Karlsson, Per; Helou, Khalil. Immunohistochemical validation of COL3A1, GPR158 and PITHD1 as prognostic biomarkers in early-stage ovarian carcinomas. Bmc Cancer. 2019;19(1):928.