Anti TRIM9 pAb (ATL-HPA041489)

Atlas Antibodies

Catalog No.:
ATL-HPA041489-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: tripartite motif containing 9
Gene Name: TRIM9
Alternative Gene Name: RNF91, SPRING
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021071: 100%, ENSRNOG00000007031: 100%
Entrez Gene ID: 114088
Uniprot ID: Q9C026
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QCHRSLILDDRGLRGFPKNRVLEGVIDRYQQSKAAALKCQLCEKAPKEATVMCEQCD
Gene Sequence QCHRSLILDDRGLRGFPKNRVLEGVIDRYQQSKAAALKCQLCEKAPKEATVMCEQCD
Gene ID - Mouse ENSMUSG00000021071
Gene ID - Rat ENSRNOG00000007031
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TRIM9 pAb (ATL-HPA041489)
Datasheet Anti TRIM9 pAb (ATL-HPA041489) Datasheet (External Link)
Vendor Page Anti TRIM9 pAb (ATL-HPA041489) at Atlas Antibodies

Documents & Links for Anti TRIM9 pAb (ATL-HPA041489)
Datasheet Anti TRIM9 pAb (ATL-HPA041489) Datasheet (External Link)
Vendor Page Anti TRIM9 pAb (ATL-HPA041489)