Anti TRIM9 pAb (ATL-HPA041489)

Atlas Antibodies

Catalog No.: ATL-HPA041489-25

Protein Description: tripartite motif containing 9
Gene Name: TRIM9
Alternative Gene Name: RNF91, SPRING
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021071: 100%, ENSRNOG00000007031: 100%
Entrez Gene ID: 114088
Uniprot ID: Q9C026
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QCHRSLILDDRGLRGFPKNRVLEGVIDRYQQSKAAALKCQLCEKAPKEATVMCEQCD
• Gene Sequence: QCHRSLILDDRGLRGFPKNRVLEGVIDRYQQSKAAALKCQLCEKAPKEATVMCEQCD
• Gene ID - Mouse: ENSMUSG00000021071
• Gene ID - Rat: ENSRNOG00000007031
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.