Anti TRIM73 pAb (ATL-HPA047843)

Atlas Antibodies

Catalog No.:
ATL-HPA047843-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: tripartite motif containing 73
Gene Name: TRIM73
Alternative Gene Name: TRIM50B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053388: 90%, ENSRNOG00000022483: 88%
Entrez Gene ID: 375593
Uniprot ID: Q86UV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HPVDEEKARCLEGIGGHTRGLVASLDMQLEQAQGTRERLAQAECVLEQFGNEDHHEFI
Gene Sequence HPVDEEKARCLEGIGGHTRGLVASLDMQLEQAQGTRERLAQAECVLEQFGNEDHHEFI
Gene ID - Mouse ENSMUSG00000053388
Gene ID - Rat ENSRNOG00000022483
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TRIM73 pAb (ATL-HPA047843)
Datasheet Anti TRIM73 pAb (ATL-HPA047843) Datasheet (External Link)
Vendor Page Anti TRIM73 pAb (ATL-HPA047843) at Atlas Antibodies

Documents & Links for Anti TRIM73 pAb (ATL-HPA047843)
Datasheet Anti TRIM73 pAb (ATL-HPA047843) Datasheet (External Link)
Vendor Page Anti TRIM73 pAb (ATL-HPA047843)